PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P02410_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 587aa    MW: 65035.3 Da    PI: 4.6859
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P02410_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS436.91.5e-1332185872374
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                            ++lL++cA a+s g +e+aqa++++l++++s +gdp qRlaay++e+Laar+a+s++++ykal+++e +   +s++l+a+++++ev+P
  GSMUA_Achr3P02410_001 218 KQLLFDCAAAISVGCMEEAQAIITELRQIVSIQGDPPQRLAAYMVEGLAARIASSGQGIYKALRCKEPP---TSDRLSAMQILFEVCP 302
                            589*****************************************************************9...9*************** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                            ++kf++++aN +I+ea+  ee+vHiiDfdi+qG Q+++L+q+L++ p++ p+lRi gv++pes+      le +g+rL+k+Aeelgvp
  GSMUA_Achr3P02410_001 303 CFKFGYMAANYTIVEALGDEEKVHIIDFDINQGSQYINLIQTLSTWPSKRPHLRISGVDDPESVqrAVGGLEIIGQRLEKLAEELGVP 390
                            **************************************************************99878889****************** PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                            fef++ +a +++d+++e+L++++gEal+Vn+++qlh+++desvs+ ++rd++L++vk+l+Pk+v+++eq++++n+++F+ rf+e  +y
  GSMUA_Achr3P02410_001 391 FEFQA-IAAKTSDVTPEMLDCRSGEALVVNFAFQLHHMPDESVSTVNQRDQMLRMVKGLRPKLVTLIEQDMNTNTAPFFPRFVEVYNY 477
                            *****.6999****************************************************************************** PP

                   GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                            ++a+f+sl+a+lpr+s +r++vEr++l+r+ivn+vacega+r+er e ++kWr+r+++aGFkp p+s++++ ++ +ll+ + ++ y+ 
  GSMUA_Achr3P02410_001 478 HTAVFESLDATLPRDSTDRMNVERQCLARDIVNIVACEGADRIERYEVAGKWRARMTMAGFKPCPFSTSVNGSIGALLKSYCDR-YKA 564
                            **********************************************************************************66.*** PP

                   GRAS 352 eeesgslvlgWkdrpLvsvSaWr 374
                            +ee+g+l++gW+d+ L+++SaW+
  GSMUA_Achr3P02410_001 565 KEENGALYFGWEDKVLIVASAWK 587
                            **********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.8191568IPR005202Transcription factor GRAS
PfamPF035145.0E-131218587IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MSMIRSVDSS TANGDSNLHA NKSGGENSGL PRQILSGADK RMYDHRPASY KSDLHPQQHF  60
IDSSSEMIHV NPLDMSISSI PEHYSQVSSA PYQLIANFHS SILSENPYSS CIAAVQCPDS  120
SAGSNVSHQA SHSLSDYPSP EQEIDYGKDE IRLKLQELEQ ALLNDNDEDL VDSDQVVGIE  180
DNWTEPIKDL LVPCSPKESS SDLSISCIGS NREPPTPKQL LFDCAAAISV GCMEEAQAII  240
TELRQIVSIQ GDPPQRLAAY MVEGLAARIA SSGQGIYKAL RCKEPPTSDR LSAMQILFEV  300
CPCFKFGYMA ANYTIVEALG DEEKVHIIDF DINQGSQYIN LIQTLSTWPS KRPHLRISGV  360
DDPESVQRAV GGLEIIGQRL EKLAEELGVP FEFQAIAAKT SDVTPEMLDC RSGEALVVNF  420
AFQLHHMPDE SVSTVNQRDQ MLRMVKGLRP KLVTLIEQDM NTNTAPFFPR FVEVYNYHTA  480
VFESLDATLP RDSTDRMNVE RQCLARDIVN IVACEGADRI ERYEVAGKWR ARMTMAGFKP  540
CPFSTSVNGS IGALLKSYCD RYKAKEENGA LYFGWEDKVL IVASAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-572195876375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009390820.10.0PREDICTED: scarecrow-like protein 1 isoform X1
RefseqXP_009390821.10.0PREDICTED: scarecrow-like protein 1 isoform X1
RefseqXP_009390822.10.0PREDICTED: scarecrow-like protein 1 isoform X1
RefseqXP_009390823.10.0PREDICTED: scarecrow-like protein 1 isoform X1
RefseqXP_009390824.10.0PREDICTED: scarecrow-like protein 1 isoform X1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLM0SB590.0M0SB59_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P02410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1